Protein Info for Dsui_2665 in Dechlorosoma suillum PS

Annotation: putative nucleoside-diphosphate sugar epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 PF05368: NmrA" amino acids 2 to 245 (244 residues), 62.8 bits, see alignment E=8.6e-21 PF13460: NAD_binding_10" amino acids 6 to 186 (181 residues), 85.6 bits, see alignment E=8.1e-28

Best Hits

Swiss-Prot: 64% identical to QOR2_ECOLI: Quinone oxidoreductase 2 (qorB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 70% identity to pna:Pnap_0622)

MetaCyc: 64% identical to NAD(P)H:quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
1.6.5.-

Predicted SEED Role

"NADPH:quinone oxidoreductase 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPB4 at UniProt or InterPro

Protein Sequence (284 amino acids)

>Dsui_2665 putative nucleoside-diphosphate sugar epimerase (Dechlorosoma suillum PS)
MIVVTGTTGQLGRLVIQSLLQRQVPASRIVAAVRNPAKAADLAAQGIVVRQADYSQPESL
RTAFAGAEKVLLISSSEVGQRLPQHRNAIEAAQAAGVGLLAYTSLLHADTSPLGLAEEHR
QSEALLRQSGLPHVILRNGWYTENYLASVAPALQHGAYIGAAGEGRIASAARADYAEAAA
AVLTQPDQAGKVHELAGDTAYTLADLAAAITRLSGRAVPYVNLSQADFEAALLKAGLPAP
LAALLADSDAAAARGALFDDQHQLSRLIGRPTTSLEALLPSVLG