Protein Info for Dsui_2653 in Dechlorosoma suillum PS

Annotation: Tfp pilus assembly protein PilZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 PF07238: PilZ" amino acids 22 to 113 (92 residues), 42.6 bits, see alignment E=3.3e-15

Best Hits

KEGG orthology group: K02676, type IV pilus assembly protein PilZ (inferred from 79% identity to dar:Daro_2195)

Predicted SEED Role

"Type IV pilus biogenesis protein PilZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPA2 at UniProt or InterPro

Protein Sequence (128 amino acids)

>Dsui_2653 Tfp pilus assembly protein PilZ (Dechlorosoma suillum PS)
MSDTNAASSAAPAAAGARPSVLSLNINSKSALYAAYMPHLKNGGIFIPTNRRYTLGDEVF
MLLSLMEDPTKLPIAGTVVWVTPAGAQNSKAQGIGIHFNNDESGIEARRKIEGLLGGLLQ
SSRATHTI