Protein Info for Dsui_2645 in Dechlorosoma suillum PS

Annotation: heavy metal sensor kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 signal peptide" amino acids 12 to 12 (1 residues), see Phobius details amino acids 34 to 35 (2 residues), see Phobius details transmembrane" amino acids 13 to 33 (21 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details PF21085: CusS" amino acids 7 to 163 (157 residues), 102.2 bits, see alignment E=6.4e-33 TIGR01386: heavy metal sensor kinase" amino acids 8 to 462 (455 residues), 527.9 bits, see alignment E=1.2e-162 PF00672: HAMP" amino acids 187 to 240 (54 residues), 32.1 bits, see alignment 2.3e-11 PF00512: HisKA" amino acids 245 to 309 (65 residues), 47.3 bits, see alignment E=3.4e-16 PF02518: HATPase_c" amino acids 353 to 463 (111 residues), 93.4 bits, see alignment E=2.5e-30

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 59% identity to dar:Daro_2258)

Predicted SEED Role

"Heavy metal sensor histidine kinase" in subsystem Cobalt-zinc-cadmium resistance

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNV1 at UniProt or InterPro

Protein Sequence (466 amino acids)

>Dsui_2645 heavy metal sensor kinase (Dechlorosoma suillum PS)
MTPTRGPSLTLRLTLLFALASAFVLFLLGLLIGNAVERHFEEQDLDVLTGKMQLARHILE
RKPDSQPKETLTQQLDDALTGHHGLIVAVYDQNGETLYANEAMVFPQDLLSIGATPRREQ
PVKWNSNDGQPWRGISSMIKGTDGGGSYTVAIATEITHHEHFMTSFRQTLWGFMSLATLA
MGLLGWFVVRRGLLPLLAIKRQAAEITANRLHTRLPVEAIPRELADLADTLNGMLSRLEE
SFQRLSDFSSDLAHELRTPVSNLLTQTQVTLSKARSAEDYRDILASNAEEFERLSRTISD
MLFLAKADNNQIIPNREAIDLAEEIGDLLEYYDVLAEEKSIDLSFSGAGQILGDRLMLRR
AISNLLSNALRHTPNDGVVTVQIEERDDGLTHIAVENTGNEIPAEHLPRLFDRFYRVDSS
RLRTTENSGLGLAITQSIVIAHGGKVRVQSTAEKTRFTLSLPSSHR