Protein Info for Dsui_2636 in Dechlorosoma suillum PS

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00529: CusB_dom_1" amino acids 13 to 325 (313 residues), 31.7 bits, see alignment E=2.3e-11 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 111 to 411 (301 residues), 148.4 bits, see alignment E=1.2e-47 PF16576: HlyD_D23" amino acids 117 to 338 (222 residues), 270.1 bits, see alignment E=2.2e-84 PF13437: HlyD_3" amino acids 234 to 334 (101 residues), 66.5 bits, see alignment E=6.7e-22 PF11604: CusF_Ec" amino acids 445 to 516 (72 residues), 88 bits, see alignment E=5.8e-29

Best Hits

KEGG orthology group: K07798, Cu(I)/Ag(I) efflux system membrane protein CusB (inferred from 85% identity to app:CAP2UW1_4655)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNU2 at UniProt or InterPro

Protein Sequence (529 amino acids)

>Dsui_2636 RND family efflux transporter, MFP subunit (Dechlorosoma suillum PS)
MNKGAGLTIGVIAVAVAAGSGYWLGGRGGASHGDAVPVASAPAEPAKKEKKLLFYRNPMG
LPDTSPVPKKDPMGMDYIAVYEGEQDEEPASANQIKISTEKVQKLGVRTEVAQLRVLDKV
VRAAGRIEPDERRIYAISPKFEGYVERLHVNVTGQPVSKGQPLFEVYSPELVSAQREYAI
AAQGVESLKEAGGQARDGMKQLADSSLLRLKNWDISEEQVKALAKSGEARRTLTFRSPVA
GIVTEKKALQGMRFMPGEALYQVADLSAVWVVADVFEQDIGQVKTGAKAKVRINAYPDKV
FEGTITYVYPTLKAETRTVPVRVELPNPSQLLKPAMFAQVELPVGAKGEVVTVPTSAVID
SGTRRIVLVQAKEGRFEPREVKLGQRSDNHVEVLEGIKDGEPVVVAANFLIDAESNLKAA
VGGFGHASHGSQPKPESAKSAAVGHQAEGTVEGFDTKAGLLTLNHGPVASLKWPGMTMEF
QVATPALLSGLKPGATVAFEFVERKPGEWVVTSIKPMAGKVAANPHAGH