Protein Info for Dsui_2572 in Dechlorosoma suillum PS

Annotation: conjugative coupling factor TraD, TOL family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 697 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR03743: conjugative coupling factor TraD, SXT/TOL subfamily" amino acids 5 to 640 (636 residues), 733.8 bits, see alignment E=1.8e-224 TIGR03754: conjugative coupling factor TraD, PFGI-1 class" amino acids 6 to 641 (636 residues), 827.6 bits, see alignment E=7.5e-253 PF12696: TraG-D_C" amino acids 497 to 621 (125 residues), 43.8 bits, see alignment E=2.3e-15

Best Hits

KEGG orthology group: None (inferred from 62% identity to bug:BC1001_1953)

Predicted SEED Role

"Type IV secretory pathway, VirD4 components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN83 at UniProt or InterPro

Protein Sequence (697 amino acids)

>Dsui_2572 conjugative coupling factor TraD, TOL family (Dechlorosoma suillum PS)
MSYPFENLFRKPYELIPAATSLAAVPTALCFRDLLQLSPAAATAFALGCLGHSAWRFNQG
RQVLRFHRNLKRLPSYVLRSEDIPWSDREQFLGQGFRWDQRHTQRLFTARQPAYAHLRAR
NRLYDRARDFERKHPGHWLAKRLREESWWNPVPPLPPIGGDPAIHGIELDELEQWVDLGE
RVGHTLVLGTTRVGKTRLLELLVTQDIRRGDVVICFDPKGDEGLLRRMYAEAKRAGRESE
FYFFHLGYPDKSARYSPIGTYAQITEVATRVANQLPGEGQSAAFKEFVWRYVNVIAKTME
ALGIKPTYEQLYRHATNIDLLAQQYFELWLDRDHPGWRDQLELRGTTKETAEQARKTGRS
LQALNMLGLFRERGWHDPIADALGSVLTNDRSYFEKLVSSLYPLLEKLTTGRINELLSPD
MSNPDDLRPVFDWDKIINQGGIVYVGLDSLSNFEVASAVGNAMFADLTSTAGRLYKFGAG
YGQSGAIKKRKVSIHGDEFNELIGDEFVPMLNKAGGAGYQVTVYTQTWSDVEAKIGSAAK
AGQIGGNLNTLIMMRVKNTETAEILTNQLPEVTVQERMLVSGTTDSSDEHDLVGFTGKAE
DRFSLRNVPMIQPADLVQLPKGQAFCLVEGGQLIKVRLPLASDEDDDCMPPDLEDVAIDM
GRKYNRYIDAEAQGLVSGIRPWEQVTTAGRGSSYGIQ