Protein Info for Dsui_2539 in Dechlorosoma suillum PS

Annotation: polyhydroxyalkanoate synthesis repressor PhaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 TIGR01848: polyhydroxyalkanoate synthesis repressor PhaR" amino acids 6 to 112 (107 residues), 149.5 bits, see alignment E=1.9e-48 PF07879: PHB_acc_N" amino acids 7 to 66 (60 residues), 104.6 bits, see alignment E=2.3e-34 PF05233: PHB_acc" amino acids 71 to 110 (40 residues), 62.7 bits, see alignment 2.8e-21 amino acids 127 to 164 (38 residues), 54.4 bits, see alignment 1.1e-18

Best Hits

KEGG orthology group: None (inferred from 76% identity to tmz:Tmz1t_3121)

Predicted SEED Role

"PhbF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN50 at UniProt or InterPro

Protein Sequence (187 amino acids)

>Dsui_2539 polyhydroxyalkanoate synthesis repressor PhaR (Dechlorosoma suillum PS)
MTEPARLIKKYPNRRLYDTKTSAYITLADVKELVLRFEDFKVVDAKSGEDLTRSILLQII
LEEESGGMPLFSSELLAQIIRYYGNAMQGMLGKYLETNIKAFADVQAKLQEQSRSLYGEA
NQVQAQTDLWAQFLNFQGPAMQSMMSAYVDQSKKMFQQMQDQLQSQTRNMFTGFQFPGAQ
PDDRKGE