Protein Info for Dsui_2500 in Dechlorosoma suillum PS

Annotation: site-specific recombinase, DNA invertase Pin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 PF00239: Resolvase" amino acids 3 to 142 (140 residues), 146 bits, see alignment E=4.3e-47

Best Hits

Swiss-Prot: 54% identical to GIN_BPD10: Serine recombinase gin (gin) from Escherichia phage D108

KEGG orthology group: None (inferred from 100% identity to adn:Alide_4496)

MetaCyc: 50% identical to e14 prophage; site-specific DNA recombinase (Escherichia coli K-12 substr. MG1655)
5.99.1.-

Predicted SEED Role

"Resolvase/integrase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMM1 at UniProt or InterPro

Protein Sequence (204 amino acids)

>Dsui_2500 site-specific recombinase, DNA invertase Pin (Dechlorosoma suillum PS)
MLIGYMRVSKADGSQATDLQRDALIAAGVDPVHLYEDQASGMREDRPGLTSCLKALRTGD
TLVVWKLDRLGRDLRHLINTVHDLTGRGIGLKVLTGHGAAIDTTTAAGKLVFGIFAALAE
FERELIAERTIAGLASARARGRKGGRPFKMTAAKLRLAMAAMGQPETKVGDLCQELGVTR
QTLYRHVSPKGELRPDGEKLLSRI