Protein Info for Dsui_2487 in Dechlorosoma suillum PS

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF02646: RmuC" amino acids 193 to 480 (288 residues), 246.5 bits, see alignment E=1.6e-77

Best Hits

KEGG orthology group: K09760, DNA recombination protein RmuC (inferred from 64% identity to bgl:bglu_1g09340)

Predicted SEED Role

"DNA recombination protein RmuC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMK8 at UniProt or InterPro

Protein Sequence (502 amino acids)

>Dsui_2487 hypothetical protein (Dechlorosoma suillum PS)
MTDTLLLILTVLALLILGGLVLLLLRSRERQDAALALAPQFAAVDGALARQERALREELA
AIRQESALEARRGREEQSEALVRLTQALGSQVGQLGQLQAQQLEVFAQQLARSRQEAAAE
SHQGREAQAQGLARLAESLNAQVGQFGQTQGQHLEAFAQQLAQVSQALDQRFEQLRQVVE
ARLVALQADNAGKLEEMRKTVDEKLHATLEQRLGESFKLVSDRLEQVHRGLGEMQTLAAG
VGDLKKVLTNVKTRGSWGEVQLSNLLEQILTPEQYATNVITRPRSNDRVEFAIRLPGKGD
GLADAPVWLPIDAKFPIEDYQKLQDAQERADAAGVEEAAKALENRLKLEAKSIREKYVEP
PHTTDFALLYLPIEGLYAEALRRPGLAEMLQREYRVSLSGPTTLTAMLNSLQMGFRTLAI
EKRSSEVWSVLGAVKTEFGKFGEALAATKKKLEQATNSIGAAEVRTRQIERKLKSVEALP
SGEASGLLSGLESLEVSEDSQE