Protein Info for Dsui_2486 in Dechlorosoma suillum PS

Annotation: diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF00072: Response_reg" amino acids 4 to 116 (113 residues), 78.4 bits, see alignment E=4.6e-26 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 142 to 308 (167 residues), 184.5 bits, see alignment E=6.5e-59 PF00990: GGDEF" amino acids 147 to 306 (160 residues), 185 bits, see alignment E=8.8e-59

Best Hits

KEGG orthology group: None (inferred from 58% identity to dar:Daro_1597)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMK7 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Dsui_2486 diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MKTLVVEDAKTSLAVVCHHLERLGNIPVPASCGAQAIELFQSERPDLVLLDVVLPDMDGY
TVARRIRDLEKPGEWTPIIFLTAMSGDADLEKGIAAGGDDYLQKPVSDVVLRAKIRAMQR
IVQMRHSLLVLTRKLDAANQELKRLSAVDGLTGVANRRMFDEALEREWRRSMRQGTELAI
VMCDVDFFKKFNDTYGHQAGDECLKKVASAMAKAMERGGDLLARYGGEEFSIILPDTKLG
GAAFVAERMRHSVAQLKMPHAGSHHGQVTISCGVSAFVASPETSPEALLLAADQALYQAK
QAGRNQVCRMSTAPAPCPAP