Protein Info for Dsui_2465 in Dechlorosoma suillum PS

Annotation: beta-glucosidase-like glycosyl hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF00933: Glyco_hydro_3" amino acids 23 to 295 (273 residues), 224 bits, see alignment E=1.7e-70

Best Hits

Swiss-Prot: 60% identical to NAGZ_BORA1: Beta-hexosaminidase (nagZ) from Bordetella avium (strain 197N)

KEGG orthology group: K01207, beta-N-acetylhexosaminidase [EC: 3.2.1.52] (inferred from 64% identity to app:CAP2UW1_1555)

MetaCyc: 48% identical to beta-N-acetylglucosaminidase (Escherichia coli K-12 substr. MG1655)
Beta-N-acetylhexosaminidase. [EC: 3.2.1.52]

Predicted SEED Role

"Beta N-acetyl-glucosaminidase (EC 3.2.1.52)" (EC 3.2.1.52)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMJ1 at UniProt or InterPro

Protein Sequence (341 amino acids)

>Dsui_2465 beta-glucosidase-like glycosyl hydrolase (Dechlorosoma suillum PS)
MNAPRQLPPGPVMIDIQGLALTDLDRERLTHPLVGGLILFSRNYESPEQLSALCAEVKAL
RSPQLLIAIDHEGGRVQRCRPGFTAIPAMGKLGALWDAAPGEAIAAAQDLGYVLAAELRA
RGVDFSFTPVLDLDYGRSTVIGSRSFHRQPEAVVQLAGALIQGLQLAGMGCCGKHFPGHG
WVQADSHVAIPVDERDWDKLLADMEPFRRLALDAVMPAHVIYPVVDQKSAGFSNYWINYL
RNNLKFDGVVFSDDLSMEGASVAGDVVARAQAAWSAGCDMLLVCNAPEAVGQLLERWQPS
LDPVRAARVQRLLPQKPAPDWADLQADPVYQRGVAAAGRLA