Protein Info for Dsui_2460 in Dechlorosoma suillum PS

Annotation: ribonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 TIGR02191: ribonuclease III" amino acids 14 to 228 (215 residues), 237.2 bits, see alignment E=7.4e-75 PF14622: Ribonucleas_3_3" amino acids 24 to 145 (122 residues), 126.2 bits, see alignment E=1.9e-40 PF00636: Ribonuclease_3" amino acids 43 to 133 (91 residues), 83.2 bits, see alignment E=4.1e-27 PF00035: dsrm" amino acids 161 to 228 (68 residues), 41.9 bits, see alignment E=2.5e-14

Best Hits

Swiss-Prot: 62% identical to RNC_DECAR: Ribonuclease 3 (rnc) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 64% identity to app:CAP2UW1_1550)

MetaCyc: 55% identical to RNase III (Escherichia coli K-12 substr. MG1655)
Ribonuclease III. [EC: 3.1.26.3]

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMI6 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Dsui_2460 ribonuclease III (Dechlorosoma suillum PS)
MAEKIRLTAPQAAFSRRLGHEFADPSLLRTALTHRSHSSPHNERLEFLGDSILNCVVAHL
LFERFPLLPEGDLSRLRANLVKKDTLHELALGLDLGEQLRLGEGELKSGGHTRPSILADA
LEALFGAVYLDAGFDRAKVVVGNLFTAKLDAIAPDQPIKDPKTRLQEYLQARRQPLPVYT
LAATDGQAHLQQFRVLCEVASAALQTEGQGSSRRAAEQEAASRALEKLKA