Protein Info for Dsui_2445 in Dechlorosoma suillum PS

Annotation: fatty acid/phospholipid synthesis protein PlsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 254 to 271 (18 residues), see Phobius details TIGR00182: fatty acid/phospholipid synthesis protein PlsX" amino acids 4 to 330 (327 residues), 376.3 bits, see alignment E=7.1e-117 PF02504: FA_synthesis" amino acids 4 to 322 (319 residues), 370.2 bits, see alignment E=4.5e-115

Best Hits

Swiss-Prot: 71% identical to PLSX_DECAR: Phosphate acyltransferase (plsX) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K03621, glycerol-3-phosphate acyltransferase PlsX [EC: 2.3.1.15] (inferred from 78% identity to app:CAP2UW1_1535)

Predicted SEED Role

"Phosphate:acyl-ACP acyltransferase PlsX" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMH1 at UniProt or InterPro

Protein Sequence (346 amino acids)

>Dsui_2445 fatty acid/phospholipid synthesis protein PlsX (Dechlorosoma suillum PS)
MGITIAIDCMGGDHGPNVTVPAALDFLRRNADARVILVGLEEKLRAILPAPVPERVAIRH
ASEVVAMDEPPALALRNKKDSSMRVAINLVKEGEADACISAGNTGALMAISRFVLKMLPG
IDRPAICAVLPTVKGHVHVLDMGANVDCSPEHLLQFGIMGAMLVAAVDHREQPTVGILNI
GEEDIKGNEVVKQAAELLRNSGLNFIGNVEGDGVYKGEAEVVVCDGFVGNVALKTSEGLA
QMLSTFLRQEFGRNLFTKLVALLALPVLKGFKRRVDHRRYNGASLLGLKGIVVKSHGSAD
AYGFRHAIERAAEEARGQVLSRIADQVARHVSSSSQAAAVAAQESA