Protein Info for Dsui_2439 in Dechlorosoma suillum PS

Annotation: ferredoxin subunit of nitrite reductase and ring-hydroxylating dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 PF00355: Rieske" amino acids 30 to 95 (66 residues), 26 bits, see alignment E=3.6e-10

Best Hits

KEGG orthology group: None (inferred from 68% identity to app:CAP2UW1_1529)

Predicted SEED Role

"Ferredoxin, 2Fe-2S" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMG5 at UniProt or InterPro

Protein Sequence (116 amino acids)

>Dsui_2439 ferredoxin subunit of nitrite reductase and ring-hydroxylating dioxygenase (Dechlorosoma suillum PS)
MATSPRLICASGDLLEGGAGVRFSVPRAGGDVPAFAVRFDGVVRAYLNRCAHVPIELDWQ
PGEFFDHSKLYLVCATHGALYAPESGACLGGRCNGRGLTPVAVTEQDGLVYFLESD