Protein Info for Dsui_2437 in Dechlorosoma suillum PS

Annotation: pseudouridine synthase, RluA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 TIGR00005: pseudouridine synthase, RluA family" amino acids 17 to 319 (303 residues), 254.5 bits, see alignment E=6.5e-80 PF01479: S4" amino acids 21 to 66 (46 residues), 33.3 bits, see alignment 3.2e-12 PF00849: PseudoU_synth_2" amino acids 104 to 256 (153 residues), 91.5 bits, see alignment E=6.5e-30

Best Hits

Swiss-Prot: 52% identical to RLUC_SALTY: Ribosomal large subunit pseudouridine synthase C (rluC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K06179, ribosomal large subunit pseudouridine synthase C [EC: 5.4.99.12] (inferred from 69% identity to app:CAP2UW1_1527)

MetaCyc: 52% identical to 23S rRNA pseudouridine955/2504/2580 synthase (Escherichia coli K-12 substr. MG1655)
RXN-11838 [EC: 5.4.99.24]

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase C (EC 4.2.1.70)" in subsystem Ribosome biogenesis bacterial (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12 or 5.4.99.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMG3 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Dsui_2437 pseudouridine synthase, RluA family (Dechlorosoma suillum PS)
MPDVSKNSVTRATIGEDEQGQRLDNYLLRVCKGVPKSHIYRILRSGEVRVNSKRADAAYR
IQAGDILRIPPIRVAARPDEVAAAEVAGQAVKADLPLLYEDDALLAVNKPAGIAVHGGSG
VSFGVIEALRHQRPQAKLLELAHRLDRETSGILLVAKKRSALTALHDMFREGGAGRGADK
RYLVAVQGRWMDPLRHCRQALHKYLLDNGERRVRVDPEGKPSHTVFRLVARWQRFSLLEA
ELKSGRTHQIRVHLAHLGYPILGDDKYGDFALNRELQREGLKRMFLHAWRMRFPHPLTKE
AMSLEAPLPPALASFLHHLSESEVQDYGEAF