Protein Info for Dsui_2419 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 999 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details PF22588: dCache_1_like" amino acids 183 to 269 (87 residues), 32 bits, see alignment E=4.5e-11 PF13188: PAS_8" amino acids 332 to 379 (48 residues), 23.6 bits, see alignment 1.4e-08 amino acids 451 to 498 (48 residues), 25.2 bits, see alignment 4.5e-09 TIGR00229: PAS domain S-box protein" amino acids 332 to 447 (116 residues), 52.5 bits, see alignment E=5.2e-18 amino acids 452 to 569 (118 residues), 60.6 bits, see alignment E=1.7e-20 PF00989: PAS" amino acids 332 to 438 (107 residues), 40.8 bits, see alignment E=8.1e-14 amino acids 453 to 551 (99 residues), 36.5 bits, see alignment E=1.7e-12 PF08448: PAS_4" amino acids 334 to 442 (109 residues), 60.2 bits, see alignment E=9e-20 amino acids 455 to 564 (110 residues), 34.1 bits, see alignment E=1.1e-11 PF13426: PAS_9" amino acids 338 to 439 (102 residues), 34.6 bits, see alignment E=7.9e-12 amino acids 460 to 562 (103 residues), 57.9 bits, see alignment E=4.4e-19 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 571 to 728 (158 residues), 97.5 bits, see alignment E=6.9e-32 PF00990: GGDEF" amino acids 575 to 726 (152 residues), 123.7 bits, see alignment E=2.5e-39 PF00563: EAL" amino acids 748 to 982 (235 residues), 251.5 bits, see alignment E=3e-78

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLY9 at UniProt or InterPro

Protein Sequence (999 amino acids)

>Dsui_2419 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MPLRRSTYLLATLVGLLWLGLVVWISMDVLQSREMAMDAARRQGEALARVLESSLQGSIQ
KVDLRLQEFVRRHQYAVAAGRPREELEPELNRSLGMFPEALSFRVADTQGRYIYDASGVL
ASNVNIADRDYFRLLQDQPGAGLVVSGPMQSRVTGDWVLVAARRLQDEGGTFQGVVLASL
RVKYFESLFGTLNLGPRDTIALWTRDMRLMARWPHLEARMGQPVANSPTQDFLQRGETSG
SFIRTGELDGMDRLFVFRALPEHDFLVTVGYAIDDVLASWRHRALIYACLGLVLTVALAF
TVLVWHRRFSAATALAQRMSRAAEEKNRESLALLDAIPDPAWLLDTQGTYLSVNEAFCRY
AGRPMEEVIGHRVEDLFSEEETRRMTEGSLRVIEARSPMREEVWLDLPRGRVPFEFLRAP
VFDAAGQVRALAGVAWDISSRYEAEERRRLITHVFDHSIEAILILDATGHIVTFNNAFAE
LSGYTVEESAGQQPDFLASPCNEPDFRAQIRATLDRGENWLGEAIARRKDGSDCPVWCNI
GAIVNEQGAIVNKVAFVTDLSEKKAAQAQIETLSNVDQLTTLPNRQWFSRILGEWLQEGC
QGALVLLDLDQLSRVNDAFGHAAGDELLRRVGERLRKGLRPHDILGRLGGDQFGILIDGR
DDSRSVATVVRHLLDILAHPIQMQGSDVVTTACAGITLFPQDGNDVALLLRNVDTAMHHA
KNSNLNSYHFFAPEMNQRVVERLRLESELRLALQLDQLELHYQPQVEIGSGQINGFEALL
RWNHPELGMVSPADFIPLAEETRLILPIGAWVLKEACRQNRQWQDQGLPPMVVAVNLSAL
QFQESDLVAMVSAALMTSGLAPRWLELEITESVIMQEPERMVGILEELKCLGVRLSIDDF
GTGYSSLSYLKRFPIDKIKIDRSFIRDVVSSQGDAAIVRMVIAMAGELERKVIAEGVETN
EQLDFLRLHQCHEFQGFLCSRPVPALQVPELLAAGAEAI