Protein Info for Dsui_2409 in Dechlorosoma suillum PS

Annotation: Major Facilitator Superfamily transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 70 to 108 (39 residues), see Phobius details amino acids 125 to 149 (25 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details amino acids 206 to 222 (17 residues), see Phobius details amino acids 229 to 252 (24 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details amino acids 293 to 310 (18 residues), see Phobius details amino acids 316 to 337 (22 residues), see Phobius details amino acids 356 to 373 (18 residues), see Phobius details amino acids 379 to 398 (20 residues), see Phobius details PF07690: MFS_1" amino acids 9 to 342 (334 residues), 68 bits, see alignment E=3.8e-23

Best Hits

KEGG orthology group: None (inferred from 82% identity to app:CAP2UW1_2652)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLX9 at UniProt or InterPro

Protein Sequence (421 amino acids)

>Dsui_2409 Major Facilitator Superfamily transporter (Dechlorosoma suillum PS)
MQIGFYIIMAAQFFSALADNALLITAIYALREMQAPEAYAPLLKLFFTVSYVLLAAFVGA
FADSMPKWRVMFISNGIKIFGCALMFFHVHPLAAYAVVGLGAAAYSPAKYGILTEYLPHR
LLVLANGWIEGLTVGAIILGTVLGGALIQPKISAMLLGFDLPFVDTPIDTVVEMALCVVG
LLYLIAAVFNLYIPDTGVDHKPLKKNPWYLLHEFGHCLALLWRDRLGQISLAVTTLFWGA
GATLQFIVIKWAEAALHLDLSKSSMLQGVVALGVAVGAAVAAKFITLRKSIRVIPLGIAM
GIIVIGMNFVRDFWVAVPLLILIGALSGFFVVPMNALLQHRGHILMGAGHSIAVQNFNEN
LSILIMTGLYAAMIKADFSIYTVITLFGLFVAAAMWLVRRRHQANQRERDDVIHLDNCNA
H