Protein Info for Dsui_2404 in Dechlorosoma suillum PS

Annotation: ribosomal-protein-alanine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01575: ribosomal-protein-alanine acetyltransferase
  • amino acids 23 to 153 (131 residues), 124.8 bits, E=1.2e-40
• PF00583: Acetyltransf_1
  • amino acids 25 to 132 (108 residues), 65.8 bits, E=1.1e-21
• PF13673: Acetyltransf_10
  • amino acids 40 to 138 (99 residues), 39.2 bits, E=1.7e-13
• PF13508: Acetyltransf_7
  • amino acids 52 to 134 (83 residues), 56.2 bits, E=9.1e-19
• PF08445: FR47
  • amino acids 72 to 135 (64 residues), 27.3 bits, E=7.2e-10

Best Hits

Swiss-Prot: 36% identical to RIMI_ECOLI: [Ribosomal protein S18]-alanine N-acetyltransferase (rimI) from Escherichia coli (strain K12)

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 56% identity to app:CAP2UW1_2659)

MetaCyc: 36% identical to protein N-acetyltransferase RimI (Escherichia coli K-12 substr. MG1655)
2.3.1.128-RXN [EC: 2.3.1.266]; 2.3.1.- [EC: 2.3.1.266]

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128 or 2.3.1.266

Sequence Analysis Tools

See G8QLX4 at UniProt or InterPro

Protein Sequence (163 amino acids)

>Dsui_2404 ribosomal-protein-alanine acetyltransferase (Dechlorosoma suillum PS)
MRSLSALAAELAPLEFLPMNGKDLAQIMEIENRVYSHPWTQGNFADSMKAGYSCWVAREG
GALVGYMVLMPSLDETHLLNISVAAERQGRGYGARLLRFAMEVSRHGGAVTMLLEVRPSN
AKALALYENYGFQVIGRRKGYYPAVEGREDALVLRRELGEIAA