Protein Info for Dsui_2400 in Dechlorosoma suillum PS

Annotation: signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details PF16524: RisS_PPD" amino acids 47 to 153 (107 residues), 98.6 bits, see alignment E=5.5e-32 PF00672: HAMP" amino acids 180 to 229 (50 residues), 33.2 bits, see alignment 1.1e-11 PF00512: HisKA" amino acids 236 to 293 (58 residues), 41.6 bits, see alignment 2.2e-14 PF02518: HATPase_c" amino acids 334 to 440 (107 residues), 75.5 bits, see alignment E=9.1e-25

Best Hits

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 50% identity to tmz:Tmz1t_2260)

Predicted SEED Role

"Osmolarity sensory histidine kinase EnvZ"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLX0 at UniProt or InterPro

Protein Sequence (442 amino acids)

>Dsui_2400 signal transduction histidine kinase (Dechlorosoma suillum PS)
MKLPRPLQRLLPRTLLVRAFILVAVLLLVSVSVWVALFRAAEREPRARQLAQLTASVANI
TRAALLSADPVLRRDLLRELSEREGLRLYPAEEQDRVTPLPDREFFTIFQREAFQLMGPQ
ASFAIAVNDQPGFWIRFSMEEGDDYWLVLPRERTERNPTWQWLGWGAVSLVLSLVVAWLI
VARIARPLKIMARAARAVGRGERPPTLAEEGAEEVRLLARAMNQMSADLARLESERALVL
AGISHDLRTPLARMRLAAEMGVEDESLRAGMNDDITQMDGIIGQFLDYARGEEQEPEESA
DPNQLLATLARRCQERQEPVQLQTSPLPPLRLRPRALERALTNLIGNARKYGGGDITLAS
GIADGQAFLAVLDRGPGIPPAEVERLKRPFTRLEAARSDTTGTGLGLAIVERIARLHGGR
LELSPREGGGLAARLLLPLPPA