Protein Info for Dsui_2398 in Dechlorosoma suillum PS

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 50 to 68 (19 residues), see Phobius details amino acids 74 to 91 (18 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 126 to 143 (18 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 210 to 227 (18 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details amino acids 264 to 280 (17 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 43% identity to ant:Arnit_2042)

Predicted SEED Role

"FIG00636320: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLW8 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Dsui_2398 hypothetical protein (Dechlorosoma suillum PS)
MYNDEDLAAAVRDGVLSQEAVDAFHAYMVQGRPLPVVDEEHFRLVSGFNDIFVVIACLLL
LAALGWLGSRVHDGAGPLLVAATAWGLAEFFTRQRRLALPSIVLLLAFVGGLVGMTVAVL
RPLDSVSLPLAGLLGGLGAWLHWRRFRVPITVAAGAAAVAGTLLAMLFLRSTLAREWYAP
ITFVAGTAVFALAMAWDTADPQRKTRRADVAFWLHLLAAPLLVHPIFTSLQMFSREATLV
QAAAALLIYALLGLLSLAIDRRALMVSALAYLLYAFTALLKNLGMVSLSFAFTALCIGAA
LLLLSAFWHTCRSRVVSVLPAPWQERLPPLH