Protein Info for Dsui_2372 in Dechlorosoma suillum PS

Annotation: FeS cluster assembly scaffold IscU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 TIGR01999: FeS cluster assembly scaffold IscU" amino acids 3 to 126 (124 residues), 221.9 bits, see alignment E=9.2e-71 PF01592: NifU_N" amino acids 3 to 126 (124 residues), 182.5 bits, see alignment E=1.7e-58

Best Hits

Swiss-Prot: 86% identical to ISCU_ECOL6: Iron-sulfur cluster assembly scaffold protein IscU (iscU) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K04488, nitrogen fixation protein NifU and related proteins (inferred from 91% identity to dar:Daro_1951)

MetaCyc: 86% identical to scaffold protein for iron-sulfur cluster assembly (Escherichia coli K-12 substr. MG1655)
RXN-14381

Predicted SEED Role

"Iron-sulfur cluster assembly scaffold protein IscU" in subsystem Wyeosine-MimG Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLU2 at UniProt or InterPro

Protein Sequence (129 amino acids)

>Dsui_2372 FeS cluster assembly scaffold IscU (Dechlorosoma suillum PS)
MAYSVKVLDHYENPRNVGSFTKEEEGGVGTGMVGAPACGDVMKLQIKVNKEGVIEDAKFK
TYGCGSAIASSSLVTEWVKGKSLDQALEIKNTDIAEELALPPVKIHCSILAEDAIKAAVA
DYKKKHGDN