Protein Info for Dsui_2365 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 974 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 293 to 313 (21 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 403 to 526 (124 residues), 68.8 bits, see alignment E=4.9e-23 PF13188: PAS_8" amino acids 407 to 449 (43 residues), 27.5 bits, see alignment (E = 7.6e-10) PF00989: PAS" amino acids 408 to 506 (99 residues), 39.3 bits, see alignment E=2.1e-13 PF08448: PAS_4" amino acids 412 to 521 (110 residues), 32.8 bits, see alignment E=2.4e-11 PF13426: PAS_9" amino acids 417 to 519 (103 residues), 35.1 bits, see alignment E=4.9e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 528 to 690 (163 residues), 157.1 bits, see alignment E=3.2e-50 PF00990: GGDEF" amino acids 531 to 688 (158 residues), 174.7 bits, see alignment E=4.4e-55 PF00563: EAL" amino acids 708 to 947 (240 residues), 251.6 bits, see alignment E=2.4e-78

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLT5 at UniProt or InterPro

Protein Sequence (974 amino acids)

>Dsui_2365 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MTAPNWLPSIKAKLLALLLLSIFLVLTVVGTLLSVGVERFHREETREVFATAQRALSAEI
QTRQAFLLQMAGRLAADEALVASLNLVSRYSDPLHYDPLVFDGEKKRLAGDLVRLSSATD
HLSLVVVDSRGQWVAFGRVEKNGQEAGFLSFDNAGAPLAWQQDSLSPNQWHAGRTPVEVE
FLAGLARNAPPTQAMVRSPDGLMLLASAPVIRHFPRGEPLTVGRVVVTQTLGQGFLEQVT
RYTPLHFGLLFAQGQVVGDIQALASEVDLSRAAPLLKNAGNPLSGWQETPRHFLMLFSLP
LLGNELAYPLLVLEKEGVNKQVRETLGVLLLVLLLAGALVVPLSQALANRGISRPVLNLL
ASVERVKAGQYDGIAGQAPGSVEFASLFDSLQDMAHTIRSREDQLRLWASVLEQSREAVF
VTDAENRILLVNRAFVAVTGYTLEEVRGRTPRFLQSGRHDEAFYVNLWRSLRETGHWQGE
IWDRAKDGRIHPQWAAISAVADAAGTVSNYIAIYSDLTEHKAAQDRIQFLAQHDPLTGLP
NRMLLQDRLTVAIAAAAREGHEVGVLFIDLDRFKTINDSLGHSVGDELIKGVTKRLQDAV
RESDTVSRLGGDEFIVVLHRIRRSEDAAHVADAVLAQLTAPFNIAGKELRVTASIGISVF
PADGEDEEGLIKNADTAMFHAKERGRNNYQFFRPEMNARAGERLALENSLRGAVQRKEFV
LFYQPQVEIRSGRLVGAEALIRWRRGDSGFVSPADFIPLAEETGTILEIGDWVLAEACRQ
QVQWDQQWPAMGLKPVPVAVNLSSLQFRQKHFKENLLDIVGDYPLPAGRIELELTESIVM
EEPEQVGAVLAELKQAGLRLSIDDFGTGYSSLSYLKRFPLDKLKIDASFVRDIVNDSADL
AIVHAVVSLGHSLGLKVVAEGVEHEAELLILNAMGCDIAQGYHFCRPVPAEEFQAWVAAY
VPVPLRGGVPMPES