Protein Info for Dsui_2342 in Dechlorosoma suillum PS

Annotation: multidrug resistance efflux pump

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13437: HlyD_3" amino acids 200 to 311 (112 residues), 55.5 bits, see alignment E=8.3e-19

Best Hits

KEGG orthology group: K01993, HlyD family secretion protein (inferred from 46% identity to rce:RC1_2056)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL45 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Dsui_2342 multidrug resistance efflux pump (Dechlorosoma suillum PS)
MKSATLPLLLAAALPLLAACGRDAAPAYPGYVEGEYLYLAAPQAGYLKSLETPRGSRVSQ
GQALFAVAADPDAQALAEAEARIAAAREKAENLKEPRRAPEIAGLEANLRAAEAGRRLAR
TRLDQQQALARQNFVAQAKLDEAQSAFDQAVAQEEAARQQLATYRSTLGRQAEVKGAEAD
LQAAAALAAQKRWVVERKAVSAPAAGEVTETYYRPGEWVPAGAAVASLLPDNRRKLRFYV
PETALAGLKPGQAVEAACDGCTQPIRASIDFIAPQAEYTPPVIYSRGSREKLVFRIEAAP
APEQAASLRPGLPVDVRLLER