Protein Info for Dsui_2340 in Dechlorosoma suillum PS

Annotation: ABC-type multidrug transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 182 to 205 (24 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 262 to 286 (25 residues), see Phobius details amino acids 295 to 314 (20 residues), see Phobius details amino acids 320 to 341 (22 residues), see Phobius details amino acids 350 to 372 (23 residues), see Phobius details PF12679: ABC2_membrane_2" amino acids 16 to 374 (359 residues), 67.9 bits, see alignment E=1.8e-22 PF12698: ABC2_membrane_3" amino acids 33 to 369 (337 residues), 162 bits, see alignment E=4.3e-51 PF12730: ABC2_membrane_4" amino acids 175 to 303 (129 residues), 28.8 bits, see alignment E=2.4e-10 PF01061: ABC2_membrane" amino acids 182 to 341 (160 residues), 116.3 bits, see alignment E=2.9e-37

Best Hits

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 64% identity to reh:H16_A0421)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL43 at UniProt or InterPro

Protein Sequence (377 amino acids)

>Dsui_2340 ABC-type multidrug transport system, permease component (Dechlorosoma suillum PS)
MNQLSHSFSLSRWFGILLKEFIQLKRDRLTFGMIVGIPIIQLLLFGFAINSDPKHLPTAI
VMADPGPFARSYVAAMQNSDYFKIVGSVDEKEANALLDRSQVQFVVTFPPGFHRDLVRGK
APTLLVEADATDPMAAGGAISVLNKLGLEVFAPDLPGLEKTATPPLDLRVHRRYNPEGLT
SYNVVPGLLGVILTMTMVLMTGLAMTRERERGTFENLLATPATPVEVMTGKIVPYILIGL
IQVTLILLAARFIFDVPMHGNLLLLYAVVLLFICANLTLGITFSSIARNQLQAMQMTFFF
FLPSMLLSGFMFPFRGMPEWAQVVGNVLPLTHFLVLVRGILLKGNGIDMVWSSVWPILAF
IAVVLGIGLRTFRRTLD