Protein Info for Dsui_2333 in Dechlorosoma suillum PS

Annotation: uracil phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 TIGR01091: uracil phosphoribosyltransferase" amino acids 3 to 208 (206 residues), 279.1 bits, see alignment E=1.1e-87 PF14681: UPRTase" amino acids 6 to 207 (202 residues), 220.1 bits, see alignment E=2.3e-69 PF00156: Pribosyltran" amino acids 66 to 171 (106 residues), 46.1 bits, see alignment E=3.3e-16

Best Hits

Swiss-Prot: 74% identical to UPP_CHRVO: Uracil phosphoribosyltransferase (upp) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K00761, uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 78% identity to tmz:Tmz1t_0671)

MetaCyc: 68% identical to uracil phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Uracil phosphoribosyltransferase. [EC: 2.4.2.9]

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9)" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.9

Use Curated BLAST to search for 2.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL37 at UniProt or InterPro

Protein Sequence (208 amino acids)

>Dsui_2333 uracil phosphoribosyltransferase (Dechlorosoma suillum PS)
MAVIEVQHPLVQHKIGLMRAADMSTKKFRELTAELARLLTYETCRDFEVESVTIDGWAGP
VEVQRLKGKKVTVVPILRAGLGMLDGVLDLIPSAKVSVVGIARNEETLMPEPYFERFVGS
LDERLALIIDPMLATGGSLIATIDMLKRKGCAHVRAICLVAAPEGIAKLQAAHPDVDVYV
AAIDSHLNEHGYIIPGLGDAGDKIFGTK