Protein Info for Dsui_2330 in Dechlorosoma suillum PS

Annotation: 3-hydroxyacyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 PF03446: NAD_binding_2" amino acids 5 to 108 (104 residues), 24 bits, see alignment E=5.5e-09 PF02737: 3HCDH_N" amino acids 5 to 183 (179 residues), 218.7 bits, see alignment E=8.6e-69 PF00725: 3HCDH" amino acids 186 to 282 (97 residues), 119.5 bits, see alignment E=1.1e-38

Best Hits

Swiss-Prot: 59% identical to HBD_THETC: 3-hydroxybutyryl-CoA dehydrogenase (hbd) from Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIB 9385 / NCA 3814)

KEGG orthology group: K00074, 3-hydroxybutyryl-CoA dehydrogenase [EC: 1.1.1.157] (inferred from 79% identity to azo:azo1028)

MetaCyc: 62% identical to (S)-3-hydroxybutanoyl-CoA dehydrogeanse (Methylibium petroleiphilum PM1)
3-hydroxyacyl-CoA dehydrogenase. [EC: 1.1.1.35]

Predicted SEED Role

"3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Polyhydroxybutyrate metabolism (EC 1.1.1.157)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.35

Use Curated BLAST to search for 1.1.1.157 or 1.1.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL34 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Dsui_2330 3-hydroxyacyl-CoA dehydrogenase (Dechlorosoma suillum PS)
MELKTIGIVGAGTMGNGIAQAFAVSGFDVILTDISEAAVQKGVATISGSLDRLIKKEKMT
AEQKAAALAKIQTAIDVAALKSVDLIIEAATENFELKTKIFKQLDELAKPEAIIASNTSS
ISITKLAATTKRPAQVIGMHFFNPVPMMALVEVIRGLQTSDATYAAVETLSKAVGKTPVE
VKNSPGFVVNRLLCPMINEAIFALGEGLADAAAIDDAMKLGCNHPIGPLALCDMIGLDVE
LAVMQVLFEGTKDPKYRPAPLLVEMVEAGYLGRKTGKGFYTY