Protein Info for Dsui_2325 in Dechlorosoma suillum PS
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 52% identical to Y3559_CHRVO: UPF0225 protein CV_3559 (CV_3559) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)
KEGG orthology group: K09858, SEC-C motif domain protein (inferred from 54% identity to rfr:Rfer_3964)Predicted SEED Role
"UPF0225 protein YchJ"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See G8QL29 at UniProt or InterPro
Protein Sequence (134 amino acids)
>Dsui_2325 hypothetical protein (Dechlorosoma suillum PS) MSKPAPVRTCPCGSGQPYARCCGVYHGGQPAGTPEALMRSRYSAYALGLSDYLVATWAAE TCPPDLDAHTPPQPKWLELTVHEASQEGDQDGCWGRVRFTARGKDNGRAFRMGETSRFQR RDGRWFYVDGEVTL