Protein Info for Dsui_2302 in Dechlorosoma suillum PS

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 PF12418: AcylCoA_DH_N" amino acids 3 to 34 (32 residues), 48.9 bits, see alignment (E = 1.6e-16) PF02771: Acyl-CoA_dh_N" amino acids 39 to 157 (119 residues), 51.7 bits, see alignment E=3.1e-17 PF02770: Acyl-CoA_dh_M" amino acids 162 to 234 (73 residues), 40.9 bits, see alignment E=5.5e-14 PF00441: Acyl-CoA_dh_1" amino acids 284 to 450 (167 residues), 84 bits, see alignment E=3.7e-27 PF08028: Acyl-CoA_dh_2" amino acids 306 to 442 (137 residues), 22.8 bits, see alignment E=2.8e-08 PF12806: Acyl-CoA_dh_C" amino acids 475 to 592 (118 residues), 102.5 bits, see alignment E=5.3e-33

Best Hits

KEGG orthology group: None (inferred from 75% identity to app:CAP2UW1_2342)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL06 at UniProt or InterPro

Protein Sequence (597 amino acids)

>Dsui_2302 acyl-CoA dehydrogenase (Dechlorosoma suillum PS)
MSQYNAPLRDMHFVMKELAGLEQVVQLPGYEEVDTDLSDAILEEASKFAGNVLSPINFSG
DQEGSKWHDKAVTVPAGFKEAYTQFAENGWTALACSPEFGGQGLPKLISTAVNEMWKSAN
MAFSLCPMLTTGAIEALMTAGSDALKQKFLPKMVSGEWTGTMNLTEPSAGSDLAAVRTRA
EPQGDGSYKIFGQKIFITYGDHNMTENIVHLVLARLPNAPEGVKGISLFVVPKFMVKDDG
SLGERNDAYCVSIEHKLGIHASPTAVMAFGDHGGAVGYLVGEENRGLEYMFIMMNAARFA
VGMEGVALAERAYQQAVWYAKDRIQGTELGVRGGPKVSILKHPDVRRLLMSMRSQTEAAR
ALAYVVAAAMDAAKHHPDEAVRAANQAFADLMIPVVKGHSTEMSIEVASEGVQVHGGMGF
IEETGAAQHLRDARITAIYEGTTAIQANDLIGRKMAREGGATIKAVIAEMRKLDAKLAAQ
NGADFVAIRKRFAAGVDALEQAANWIVAIFKDDIKAAHAGSVPFLRLLGIVAGGWQMARA
ALVAQEKIAGGDSDPFYAAKIVTARFFADHQLTKAQGLTDSIVDGATGTLALAEELF