Protein Info for Dsui_2296 in Dechlorosoma suillum PS

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 PF03975: CheD" amino acids 61 to 161 (101 residues), 89.2 bits, see alignment E=1e-29

Best Hits

Swiss-Prot: 55% identical to CHED2_DECAR: Probable chemoreceptor glutamine deamidase CheD 2 (cheD2) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K03411, chemotaxis protein CheD [EC: 3.5.1.44] (inferred from 61% identity to gca:Galf_1968)

Predicted SEED Role

"Chemotaxis protein CheD" in subsystem Bacterial Chemotaxis

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.44

Use Curated BLAST to search for 3.5.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL00 at UniProt or InterPro

Protein Sequence (199 amino acids)

>Dsui_2296 chemotaxis protein (Dechlorosoma suillum PS)
MTPTPDYSKMTGKELDRIAHVIRPGGWSVAGGRPISTLLGSCVAVCLFDPQLKIGGMNHF
LLPSRGKDRELDPDTILSGDYSMEVLVNALLAQGGQKRRLVAKMFGGGNIVSAILTSIGE
RNVEFATEWLQRENIPVLASDVLGPWSRKVVFVPGTGDAFCMRMPVTQSIVAQVSREEEA
YANSLSKPVPPAGKKIELF