Protein Info for Dsui_2275 in Dechlorosoma suillum PS
Annotation: putative transcriptional regulator
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 67% identical to YOZG_BACSU: Uncharacterized HTH-type transcriptional regulator YozG (yozG) from Bacillus subtilis (strain 168)
KEGG orthology group: K07727, putative transcriptional regulator (inferred from 80% identity to rpx:Rpdx1_1094)Predicted SEED Role
No annotation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See G8QKF5 at UniProt or InterPro
Protein Sequence (75 amino acids)
>Dsui_2275 putative transcriptional regulator (Dechlorosoma suillum PS) MAIILNLDVMLARRKMRSRELAEAIGMTEQNLSLLKSGKVKGVRFSTLEAICRHLACQPG DLLEYRADEGDESLG