Protein Info for Dsui_2273 in Dechlorosoma suillum PS

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 734 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details PF07715: Plug" amino acids 73 to 173 (101 residues), 80.3 bits, see alignment E=1.4e-26 TIGR01783: TonB-dependent siderophore receptor" amino acids 75 to 734 (660 residues), 242 bits, see alignment E=7.4e-76 PF00593: TonB_dep_Rec_b-barrel" amino acids 253 to 703 (451 residues), 166.9 bits, see alignment E=1.5e-52

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 67% identity to app:CAP2UW1_3970)

Predicted SEED Role

"Outer membrane vitamin B12 receptor BtuB" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKF3 at UniProt or InterPro

Protein Sequence (734 amino acids)

>Dsui_2273 TonB-dependent siderophore receptor (Dechlorosoma suillum PS)
MLPAPVACCGRPLPHRLAPVSLAVLMIFSPLARAQSADTPRVLDEVVVRDQGLQDDLAFG
KKVVTGSRLGLSVKETPAAVTVIDREAIERRGADNTQEILKGVAGMTASSAPGSPGAVFY
RGFSGGSVTQLFNGITVQYDTIAARPVDSWIYDRVEAIGGPSSFLYGAGAIGGSINYVTK
LANRDGDFTEAKARYGSYDATQVAIGTNRRLNDRNVIRLDVNRDSARGWSKGTKREAWQM
AASLLTDLTPDLSHTLAVEYQKETVDRPYWGTPLTKPFDGKVHIDDGTRFKNYNVSDGLY
EQTVKWFRSILDYKVNDQLKLRNTLYHYDALRDYRNVETYAFNASNTRVNRSGGLLQRHD
QDVNGNRFEFNWDSTLGSLPTAWAGGLDYSLNKQTRYPASTGNTALGNVDPLAYDPGTFN
GVTGLASDVYRPDRSNRVTTLALFLENRTFLSKDLSLLTGLRQDHIDLEVTNYRTVTATD
PAYFKRTYTPLTGRAALTYDLTPNANVYVQYSTAADPPAGILATASFAQVRNFDLTTGKQ
HEIGSKFAFAEGRGHGSVAYYEITRRNIAVADPNNPGTTIPVGQQSSRGIEVNAAYQLTP
RLQASGNFSVVDAQYDDFTEKVGSVAVSRQGNRPSGIPARVTNLWLSYSPSADWRVGGDL
RYVSDRYADAANTLKAESYGLLGAFVQYKLDRKTTLTARIKNLTDKVYAENVSGTNMVYL
GAPRTLDLSVQTSF