Protein Info for Dsui_2272 in Dechlorosoma suillum PS

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 212 to 235 (24 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 463 to 486 (24 residues), see Phobius details PF03929: PepSY_TM" amino acids 9 to 352 (344 residues), 42 bits, see alignment E=5.2e-15

Best Hits

KEGG orthology group: None (inferred from 52% identity to pag:PLES_04331)

Predicted SEED Role

"Optional hypothetical component of the B12 transporter BtuN" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKF2 at UniProt or InterPro

Protein Sequence (494 amino acids)

>Dsui_2272 hypothetical protein (Dechlorosoma suillum PS)
MKRLLFLGHRWLGIALCLFMALWFLSGVVMMYVGYPKLGTAERLQTLPPLASAGCCVNLE
QALAALPAGARPRSLRLTSIGGRPVFIAGLEKNRFAAIAGHDGKAVGNIDAEAAQAAARA
FLPGQPARYLEALQEDAWTHSRALDGHRPLHVVEMDGSDDGRGRTLLYVSASTGEVVRDA
SATERTWNWLGAWLHWLYPLRGGALDGWWTEIIIYTSLAATLLALSGLVVGLLRWRRRPY
ANGSRSPYRKAMLRWHHWLGLIFGLLTFTWILSGLLSVNPWKVFDAGTPKPAPARLELAA
GTDAPGISELLQRFRADGLEARELEWLTFAGTTYVQARDGQGHSRLLPWQRQGVVQAALE
PGVLEAGGRQLLPQAGLAATHLQTEYDWHYYQRTYHSMTGHMEKALPVLRLEFDDPAHTW
LYLDPRNGALVQRLDDRLRLKRWLFALFHSWDWLPLLQHRPLWDILLIVASLGGFLVSLS
GLVIGLRRLARPRG