Protein Info for Dsui_2262 in Dechlorosoma suillum PS

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 PF12917: YfbR-like" amino acids 11 to 139 (129 residues), 53 bits, see alignment E=5.7e-18 PF13023: HD_3" amino acids 15 to 178 (164 residues), 177.2 bits, see alignment E=3.9e-56 PF01966: HD" amino acids 37 to 141 (105 residues), 27.3 bits, see alignment E=5.8e-10

Best Hits

KEGG orthology group: K07023, putative hydrolases of HD superfamily (inferred from 74% identity to reu:Reut_B5135)

Predicted SEED Role

"HMP-PP hydrolase (pyridoxal phosphatase) Cof, detected in genetic screen for thiamin metabolic genes (PMID:15292217)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKE2 at UniProt or InterPro

Protein Sequence (201 amino acids)

>Dsui_2262 hypothetical protein (Dechlorosoma suillum PS)
MSPTLAQQLTFLREIDRLKSVVRLTPLLDRSRRENSAEHSWHLALYALVLAEHAAGEVDV
LRVVKMLLIHDIVEIDAGDVPFHVPESHAGQAERERLAAERLFGLLPAAQAAEFRELWFE
FEAAQSDDARFAKALDRFQPMLHNAATEGGTWVECAVTLEQVKQRCRPPIEKGSPALWAV
AEQMAEAHLGPADGETPDQAA