Protein Info for Dsui_2250 in Dechlorosoma suillum PS

Annotation: putative domain HDIG-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 PF01966: HD" amino acids 38 to 151 (114 residues), 24 bits, see alignment E=6.1e-09 amino acids 246 to 368 (123 residues), 84.2 bits, see alignment E=1.3e-27 PF13487: HD_5" amino acids 235 to 400 (166 residues), 131.1 bits, see alignment E=5.7e-42 TIGR00277: HDIG domain" amino acids 246 to 336 (91 residues), 33.9 bits, see alignment E=1.1e-12 PF08668: HDOD" amino acids 247 to 303 (57 residues), 30.9 bits, see alignment 3e-11

Best Hits

KEGG orthology group: None (inferred from 66% identity to aha:AHA_2094)

Predicted SEED Role

"Putative metal-dependent phosphohydrolase with tandem HD motifs"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKD0 at UniProt or InterPro

Protein Sequence (420 amino acids)

>Dsui_2250 putative domain HDIG-containing protein (Dechlorosoma suillum PS)
MTVNTSPIAASYIDVDLRQVIYALSDALDLVGIDDVAHGKRVGIMAAACARVMGLDRGDT
TFLFDLGLLHDIGVSSTRTHNHLVSEFDWQMSQEHCNVGCELLRDFGPLAAMAEPVHYHH
THWQDLQGRADVSRQVAEQANLIFLVDRVDALTAPYYSSGNVLMQAPAIRQKIRDSAGTF
FAPELVEAFLQASAAEAFWLRLEPRGIQSALEDMLAQGQPCRASLAQLKQLAGIFSRIVD
AKSPFTAEHSLGVARLARHLAEAMGVPQANCERLEIAGLLHDLGKLRVPDEVLDKPGQLD
ERERKMINAHSFETYQILHRIRGFEEIAAWASYHHEEPDGSGYPFHLTVDAMSREARILR
VADIFQAMAQDRPYRAGLSADAVLQFLQELAHQGRIDAEVVAVAARDMAAAMRAARPAAA