Protein Info for Dsui_2236 in Dechlorosoma suillum PS

Annotation: ABC-type dipeptide/oligopeptide/nickel transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 57 to 76 (20 residues), see Phobius details amino acids 126 to 151 (26 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 244 to 268 (25 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details amino acids 301 to 319 (19 residues), see Phobius details PF12911: OppC_N" amino acids 45 to 95 (51 residues), 25.3 bits, see alignment 1.2e-09 PF00528: BPD_transp_1" amino acids 142 to 325 (184 residues), 102.3 bits, see alignment E=2.8e-33

Best Hits

Swiss-Prot: 37% identical to DPPC_ECO57: Dipeptide transport system permease protein DppC (dppC) from Escherichia coli O157:H7

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 57% identity to rsc:RCFBP_10591)

MetaCyc: 37% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKB6 at UniProt or InterPro

Protein Sequence (328 amino acids)

>Dsui_2236 ABC-type dipeptide/oligopeptide/nickel transport system, permease component (Dechlorosoma suillum PS)
MSESRPDSTPTPTPTPTPTSVSTSAGGGIAVRTLARLAGCRSSTFLARFAANPAGKLALL
LLALTLLTAFAGPFLAPQNPYDPAALDILDARLPPGSAAAAGGTYLLGSDEQGRDLLSAM
VYGLRLSLLVAGAGTGLACLLGAALGLTAGYFGGRWERLVLALADLQLSFPALLIALALL
ALSGPGLPKVALALAASQWAYFARSARVAALVESGKDYIAAARLQGLSHARLLWRHLLPN
CLPPLLVILPLQLAAAISLEATLSFLGLGAPATEPSLGRLIANGFAYLLSGQYWISLYPG
LLLTLAVTAITLAADRLAAVLDPRRQEG