Protein Info for Dsui_2227 in Dechlorosoma suillum PS

Annotation: NADH-quinone oxidoreductase, B subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details TIGR01957: NADH-quinone oxidoreductase, B subunit" amino acids 13 to 153 (141 residues), 238.9 bits, see alignment E=8.5e-76 PF01058: Oxidored_q6" amino acids 38 to 147 (110 residues), 102.8 bits, see alignment E=6.1e-34

Best Hits

Swiss-Prot: 82% identical to NUOB2_AZOSB: NADH-quinone oxidoreductase subunit B 2 (nuoB2) from Azoarcus sp. (strain BH72)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 82% identity to azo:azo0829)

MetaCyc: 54% identical to ferredoxin-menaquinone dehydrogenase subunit B (Helicobacter pylori 26695)
7.1.1.-

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKA7 at UniProt or InterPro

Protein Sequence (173 amino acids)

>Dsui_2227 NADH-quinone oxidoreductase, B subunit (Dechlorosoma suillum PS)
MQHAPTLYGDGYLLTQVDTLTEAVRSNSLWYLSFGLACCAVEMIHAAASRYDMDRFGMMP
RASPRQADLMIVAGTVTNKMAPALRKLYDQMAEPRYVISMGSCANGGGFYHYSYSVVRGC
DRIIPVDIYIPGCPPTAEALLYGLTQLQNLVQRRKRLIHRAEEARAAEATKGA