Protein Info for Dsui_2212 in Dechlorosoma suillum PS

Annotation: succinate dehydrogenase, hydrophobic membrane anchor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 115 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 52 to 76 (25 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details PF01127: Sdh_cyt" amino acids 7 to 102 (96 residues), 59.8 bits, see alignment E=1.4e-20 TIGR02968: succinate dehydrogenase, hydrophobic membrane anchor protein" amino acids 9 to 113 (105 residues), 127.8 bits, see alignment E=9.3e-42

Best Hits

Swiss-Prot: 39% identical to DHSD_COXBU: Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K00242, succinate dehydrogenase hydrophobic membrane anchor protein (inferred from 77% identity to dar:Daro_2864)

Predicted SEED Role

"Succinate dehydrogenase hydrophobic membrane anchor protein" in subsystem Succinate dehydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJV1 at UniProt or InterPro

Protein Sequence (115 amino acids)

>Dsui_2212 succinate dehydrogenase, hydrophobic membrane anchor protein (Dechlorosoma suillum PS)
MVNRIVVGAHYGLKDWIAQRATAVIMAVYSVILLAAVGAIGPNTYEAWRGLFANGFMKFI
TFLFFLSLFYHAWIGVRDIWMDYVKPTGIRLVLHVLTIFALLGYAGWATQILWRL