Protein Info for Dsui_2205 in Dechlorosoma suillum PS

Annotation: aconitate hydratase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00117: aconitate hydratase 2
  • amino acids 1 to 857 (857 residues), 1483.8 bits, E=0
• PF11791: Aconitase_B_N
  • amino acids 4 to 156 (153 residues), 220.6 bits, E=1.5e-69
• PF06434: Aconitase_2_N
  • amino acids 168 to 384 (217 residues), 309.2 bits, E=1.9e-96
• PF00330: Aconitase
  • amino acids 476 to 702 (227 residues), 63.8 bits, E=2.3e-21
  • amino acids 703 to 822 (120 residues), 73.8 bits, E=2.2e-24

Best Hits

Swiss-Prot: 73% identical to ACNB_PSEAE: Aconitate hydratase B (acnB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01682, aconitate hydratase 2 [EC: 4.2.1.3] (inferred from 76% identity to aex:Astex_0448)

Predicted SEED Role

"Aconitate hydratase 2 (EC 4.2.1.3)" in subsystem Propionate-CoA to Succinate Module or TCA Cycle (EC 4.2.1.3)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• glyoxylate cycle (6/6 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (8/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• partial TCA cycle (obligate autotrophs) (7/8 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• TCA cycle VII (acetate-producers) (7/9 steps found)
• nitrogen remobilization from senescing leaves (6/8 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• TCA cycle III (animals) (7/10 steps found)
• mixed acid fermentation (11/16 steps found)
• TCA cycle VI (Helicobacter) (5/9 steps found)
• reductive TCA cycle I (6/11 steps found)
• reductive TCA cycle II (6/12 steps found)
• methylaspartate cycle (11/19 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glyoxylate and dicarboxylate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.3

Use Curated BLAST to search for 4.2.1.3

Sequence Analysis Tools

See G8QJU4 at UniProt or InterPro

Protein Sequence (865 amino acids)

>Dsui_2205 aconitate hydratase 2 (Dechlorosoma suillum PS)
MLEAYRQHVAERAALGIPPLPLSAAQTKDLVALLQNPPKGEEQALVELITYRVPAGVDDA
AKVKAEFLAKVAKGELSCALISRAKATELLGTMLGGYNVKPMIDLLGDAEVGAVAAEGLK
KTLLVFDFFHDVAELAKGGNANAKAVMQSWADAEWFTSRPEVPASQKLTVFKVTGETNTD
DLSPAPDAWSRPDIPLHALAMLKNPRPGIEADKAGERGPVKQLEALAKKGNLIAYVGDVV
GTGSSRKSATNSVLWFTGEDIPFVPNKRFGGVCLGSKIAPIFFNTMEDAGALPIELDVGQ
MDMGDEIELKIDQATAKVTALKNGAVIAESQLKTPVILDEVRAGGRIPLIIGRGLTTKAR
EALGLAPSTLFRLPQQPNDPGKGYSLAQKMVGRACGLPEGKGILPGTYCEPKMTTVGSQD
TTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPKLVDVRMHRELPSFISTRGGVALRPG
DGVIHSWLNRLLLPDTVGTGGDSHTRFPIGISFPAGSGLVAFAAATGVMPLDMPESVLVR
FKGKMQPGITLRDLVNAIPLYAIKQGLLTVEKKGKKNVFSGRILEIEGLPDLKVEQAFEL
SDAAAERSAAACAIALNKEPIVEYLRSNITLMKWMIAEGYQDARTLKRRIKAMEEWIANG
TLLKADTDAQYAAVIEIDLADVKEPIVACPNDPDDVKVLSEVAGDKIDEVFIGSCMTNIG
HFRAAGKVLDGKSDIPTRLWIAPPTKMDALILTEEGYYSVLGKAGARMEMPGCSLCMGNQ
AQIRKGSTAMSTSTRNFPNRLGIDTRVYLGSAELAAMCSLLGKIPTVAEYMEYIQVVNAK
AADIYRYMNFDQIPEFVEVAETVTV