Protein Info for Dsui_2199 in Dechlorosoma suillum PS

Annotation: bacterial nucleoid DNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 90 PF00216: Bac_DNA_binding" amino acids 1 to 90 (90 residues), 114.9 bits, see alignment E=1.6e-37 PF18291: HU-HIG" amino acids 2 to 89 (88 residues), 34.8 bits, see alignment E=1.6e-12

Best Hits

Swiss-Prot: 73% identical to DBHB_NEIMB: DNA-binding protein HU-beta (hupB) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K03530, DNA-binding protein HU-beta (inferred from 86% identity to slt:Slit_1801)

Predicted SEED Role

"DNA-binding protein HU-beta" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJU0 at UniProt or InterPro

Protein Sequence (90 amino acids)

>Dsui_2199 bacterial nucleoid DNA-binding protein (Dechlorosoma suillum PS)
MNKSELIDQIAKSADISKAAAGRALDATIGAVKTSLKKGGMVTLVGFGTFYVGKRAARSG
RNPRTGATIKIKAAKVPKFRAGKALKDAVN