Protein Info for Dsui_2193 in Dechlorosoma suillum PS

Annotation: squalene synthase HpnC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 68% identity to dar:Daro_2705)

Predicted SEED Role

"Phytoene synthase (EC 2.5.1.32)" in subsystem Carotenoids (EC 2.5.1.32)

MetaCyc Pathways

neurosporene biosynthesis (2/5 steps found)
trans-lycopene biosynthesis I (2/6 steps found)
trans-lycopene biosynthesis II (oxygenic phototrophs and green sulfur bacteria) (3/8 steps found)
β-carotene biosynthesis (engineered) (2/8 steps found)
lycopadiene biosynthesis (1/7 steps found)
superpathway of carotenoid biosynthesis in plants (3/22 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.32

Use Curated BLAST to search for 2.5.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJT5 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Dsui_2193 squalene synthase HpnC (Dechlorosoma suillum PS)
MPVDHYENFPVASILLPRHLRRPVEVIYRFARSADDIADEGEAGDAERLQALATYGAELE
RIEAGITPETPLFQDLAPILVAHDLPLQPFHDLLSAFAQDITVKRYADYPALLDYCRRSA
NPVGRIMLHLFEAATPENLARSDAICTALQLINFWQDVAVDWEKQRVYLPQEDLLRFGLD
EKAIAAGQVDEAWCALMDFQVQRARQLMLDGAPLALDLPGRFGWEIRLTVEGGLRILEKI
GQVGGDVFRRRPRLGGGDWLLLACRAALFRHGCR