Protein Info for Dsui_2190 in Dechlorosoma suillum PS

Annotation: Tellurite resistance protein TehB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 PF13489: Methyltransf_23" amino acids 12 to 97 (86 residues), 28.4 bits, see alignment E=2.6e-10 PF03848: TehB" amino acids 25 to 71 (47 residues), 28.8 bits, see alignment E=1.6e-10 PF13649: Methyltransf_25" amino acids 27 to 97 (71 residues), 37.2 bits, see alignment E=7.7e-13 PF08241: Methyltransf_11" amino acids 28 to 96 (69 residues), 30.5 bits, see alignment E=9.7e-11

Best Hits

KEGG orthology group: None (inferred from 67% identity to cti:RALTA_A1180)

Predicted SEED Role

"Putative SAM-dependent methyltransferase Bucepa02006346"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJT2 at UniProt or InterPro

Protein Sequence (184 amino acids)

>Dsui_2190 Tellurite resistance protein TehB (Dechlorosoma suillum PS)
MSAPVSVLPPSSWITRFAHLLPGGGSVLDLACGSGRHARWLAARGLAVTAVDREAGAIAA
LAGLPGIEALAADLEGAPWPLAARRFDGIVVTNYLHRPLWPLLTVALAPRGVLLYETFMA
GNERFGKPSRPDFLLQPGELLEVCRQQGLQVVAYEAGEVEAPKAAMVQRLCAVRGDLPRL
PGRP