Protein Info for Dsui_2183 in Dechlorosoma suillum PS

Annotation: aldose 1-epimerase-like enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF01263: Aldose_epim" amino acids 17 to 282 (266 residues), 129.6 bits, see alignment E=8.3e-42

Best Hits

KEGG orthology group: K01792, glucose-6-phosphate 1-epimerase [EC: 5.1.3.15] (inferred from 55% identity to eba:ebA6832)

Predicted SEED Role

"Aldose 1-epimerase"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJS5 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Dsui_2183 aldose 1-epimerase-like enzyme (Dechlorosoma suillum PS)
MSASQKLGNTTFHGLDAVRLTLPDGSTAVISAFGAQALSWVPAGGGERLYLSPQADFGGS
VPIRGGVPVIFPQFAERGPLPKHGFARTATWTLEEWREQPEAEEGGFACAVYSLTADDAS
RALWPHDFRAELTVALTRDRLDIELEVENPGSEPLEFTGGLHTYLRVKEVENVTLTGLHG
SRRQLPGSQETKVETGPELMVDDEVDQVYLDVPRPLLLKDGRQALAIASEGFPDVVVWNP
WEHLCAGLKDMPANGFRHMLCVEAVAVGKPVVVAPGASWWGRQTLVTLDA