Protein Info for Dsui_2157 in Dechlorosoma suillum PS

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 792 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details transmembrane" amino acids 7 to 26 (20 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 168 to 289 (122 residues), 57.9 bits, see alignment E=5.6e-20 PF13188: PAS_8" amino acids 172 to 214 (43 residues), 27.8 bits, see alignment 6.2e-10 PF00989: PAS" amino acids 173 to 281 (109 residues), 23.2 bits, see alignment E=2.1e-08 PF08448: PAS_4" amino acids 181 to 287 (107 residues), 28.1 bits, see alignment E=7.3e-10 amino acids 304 to 419 (116 residues), 36.6 bits, see alignment E=1.6e-12 PF13426: PAS_9" amino acids 184 to 284 (101 residues), 39.1 bits, see alignment E=2.7e-13 PF08447: PAS_3" amino acids 461 to 547 (87 residues), 49.5 bits, see alignment E=1.4e-16 PF07730: HisKA_3" amino acids 583 to 648 (66 residues), 49 bits, see alignment E=2.5e-16 PF02518: HATPase_c" amino acids 691 to 780 (90 residues), 52.7 bits, see alignment E=2e-17

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJP9 at UniProt or InterPro

Protein Sequence (792 amino acids)

>Dsui_2157 PAS domain S-box (Dechlorosoma suillum PS)
MGGIWPDFLTALILVGIGWSCSLLLLDRETIPRLLSSLNLGRLLHLSLESSDLGIWCYEH
QQDRIFLDGRASLLLGLPTRAARLAEFLECVVPEDRERIRRIWLHPPTTAAPGTVEFRVG
DSHRGLRHLSLSSGLPGRGGKRRRRSGAMAMGTLQDVTERKKVEIALRESEARFSTIFRT
CPAGIALCRVADGSLVDVNPAFLHIYGLERQEVIGMTSFALHLWGSPQQREVALASILID
GRGYQSERSIRRPDGQVRHLLISVDLVFLDSERYLQWTLLDVTENRRSQALASRNEILTN
AIMNSLDVAVAVLDREGNILRTNRKWSEFALGNGAGEELAAGVGLNYFEVCRRSFPEASA
TEALAGMQAVLEERLPVASIEYPCHGPAGERWYLLQATPLGSGLQGLVTIHMDITARRQA
EEGLRQRLMLQDKLARVAASVPGVIYSIKLRPDGTFCIPYAMQGSVDIFGLRPEDLTEDL
TEDLGPVLSRIHGADQERVLAVVLESARTMAPWHCEFRVHHPQGGVRWVESKAVPRLEDD
GCVIWHGYIHDVSARKQADAELMRSRDQLRALNEGLQRVREEERSRISLEIHDQLGQSLT
VLKLEMAWLRARLLGGQAEEKTRLQEVGRLIDDTLRAVRTISWDLRPGILDTLGLGAGVE
WLVDDFRRRLGIRCNVVVPRERLELPDVLATHLFRICQELLTNVARHAQANRIDVSLGLA
DGRVLLEVRDNGRGMPMLPAHGHSLGLLGIKERAAQCGGEVHIATRPEIEGTRVRVLVPL
ITRETDIGNIGH