Protein Info for Dsui_2152 in Dechlorosoma suillum PS

Annotation: molybdenum cofactor synthesis domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 298 to 316 (19 residues), see Phobius details PF03453: MoeA_N" amino acids 2 to 163 (162 residues), 164.1 bits, see alignment E=3.3e-52 TIGR00177: molybdenum cofactor synthesis domain" amino acids 173 to 319 (147 residues), 86.8 bits, see alignment E=6.9e-29 PF00994: MoCF_biosynth" amino acids 178 to 321 (144 residues), 108.4 bits, see alignment E=3.9e-35 PF03454: MoeA_C" amino acids 338 to 402 (65 residues), 40.7 bits, see alignment E=3.5e-14

Best Hits

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 68% identity to dar:Daro_1783)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJP4 at UniProt or InterPro

Protein Sequence (408 amino acids)

>Dsui_2152 molybdenum cofactor synthesis domain protein (Dechlorosoma suillum PS)
MLSFEDALAQLLAAAKPVSEVRWLPTQAAAGRVLAQDLTSTVNVPPLDNSAMDGYAVRAA
DIPVPGTVLPVSQRIPAGSVGTTLEPGTAARIFTGAPVPPGADAVIMQERCEHAGEGRVS
FQHVPKAGENIRRAGEDVAKDARILAAGTRLGPAQLAFAASVGLAEVPVYRRLRVATFFT
GDELVMPGQPLPAGAIYNSNRYAIVALLERLGCEVKDLGQVPDSLEATRAALREAADAAD
LVVTCGGVSVGEEDHVKPAVEAEGSLNLWSIAIKPGKPLAFGEVRRSEGESAGQGSAAFI
GLPGNPVSAFVTFLMLVRPFILRSQGATEVAPRAYSLPAAGEWKKADKRREFLRASLTAE
GSVALYRHQGAGVMASLVEATGLIDNPPGQVIQAGDTVRFLSFSELLG