Protein Info for Dsui_2148 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 959 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 352 to 376 (25 residues), see Phobius details PF08269: dCache_2" amino acids 39 to 331 (293 residues), 257.1 bits, see alignment E=1e-79 PF17200: sCache_2" amino acids 83 to 218 (136 residues), 97.8 bits, see alignment E=2.9e-31 amino acids 223 to 335 (113 residues), 87.9 bits, see alignment E=3.2e-28 PF17201: Cache_3-Cache_2" amino acids 130 to 220 (91 residues), 30.8 bits, see alignment E=9.6e-11 amino acids 229 to 337 (109 residues), 40.7 bits, see alignment E=9e-14 TIGR00229: PAS domain S-box protein" amino acids 404 to 521 (118 residues), 78.4 bits, see alignment E=5e-26 PF13188: PAS_8" amino acids 405 to 443 (39 residues), 30 bits, see alignment (E = 1.8e-10) PF00989: PAS" amino acids 406 to 512 (107 residues), 58.8 bits, see alignment E=2.5e-19 PF08448: PAS_4" amino acids 407 to 516 (110 residues), 36.7 bits, see alignment E=2.2e-12 PF13426: PAS_9" amino acids 411 to 514 (104 residues), 71.9 bits, see alignment E=2.4e-23 PF08447: PAS_3" amino acids 423 to 507 (85 residues), 35.3 bits, see alignment E=5.6e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 524 to 686 (163 residues), 142.8 bits, see alignment E=8.1e-46 PF00990: GGDEF" amino acids 526 to 683 (158 residues), 172.5 bits, see alignment E=3.2e-54 PF00563: EAL" amino acids 703 to 938 (236 residues), 258.9 bits, see alignment E=2e-80

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJP0 at UniProt or InterPro

Protein Sequence (959 amino acids)

>Dsui_2148 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MSLVINEKSLPRLQLIGMLTLVLVFTLGLGIHFTLQHERDFEASLAALEAETLAQQQSLL
EAEVDSKRNYLEFVRSRTESVLKTSLKVQVDQALRLAEAIYAQEKGRRPEKEIRRLVVEA
LRPLRFFDGRGYFFIDDLAGNCVLLPTAPGREGSSLLDNRDDSGHYIMRGLIEAGTRGDG
YSRYRWYAPGNEKEMADKIAYVRHFEPFGWLIGAGDYLYQMEVDLQREALERLRSVRFAH
DGYLAVLHENGNILITPANPGIEGRRLESLGGSDEQRTIARILDLARQGGGPIRYDWINP
ATGKLSPKLSVVRPVESWGWVLIAGVYLDDLQEDLARRRSSLESGVRQHISTTALVLAVA
AGTTLLFSFFFSGWLARLFRQYREDLDSRNAQLLENARDLKLAAQVFESGNEGMVITDGD
NRIITVNQAFTRITGYRPEEVVGQNPAIFSSGRHDADFYRQMWHQLRDTGAWSGEIWNRR
KDGSLYPEWLNISSVRDEGGQASHYIAAFSDITERKAAEAQVRHLAEYDALTNLPNRVLL
QDRLGQAIAAARRAGSCLALLFLDLDRFKNINDSLGHTVGDQVLCQVGERLLTAVRASDT
VSRLGGDEFVLLLPQLESPAQAASVAEKLLLTLATPLAIDDYELAVTPSIGIAVFPEDGE
DGDTLLKNADAAMYVAKESGRNNYQYFTAAMNARVSQRLLLENNLRQALARQELALHYQP
QYDLHSGTLVGCEALLRWRQPEQGLIPPDRFIPVAEETGLILPIGQWVLREACRQAQAWQ
DAGLPPLVVAVNISAVQFRQANLAALVQEALAASGLSPCWLELELTESMLMEDGERHTQT
LAQLKAMGIRLALDDFGTGYSSLAYLKRFSLDKLKIDRSFIRDLPQDAEDAAITTAIIGM
ARDLGLETLAEGVETEQQWSFLAERGCAQMQGFLRARPMPADEITALLGRHGSATPPNG