Protein Info for Dsui_2145 in Dechlorosoma suillum PS

Annotation: FtsH-interacting integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 27 to 45 (19 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 199 to 225 (27 residues), see Phobius details PF01027: Bax1-I" amino acids 20 to 222 (203 residues), 166 bits, see alignment E=5e-53

Best Hits

Swiss-Prot: 41% identical to Y420_NEIMA: Uncharacterized protein NMA0420 (NMA0420) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K06890, (no description) (inferred from 84% identity to app:CAP2UW1_0887)

Predicted SEED Role

"Putative TEGT family carrier/transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJN7 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Dsui_2145 FtsH-interacting integral membrane protein (Dechlorosoma suillum PS)
MLPQYQMTGAGTQAGLATQNKVLRNTYLLLALSMIPTVIGAMVGVQMGFSFFAGSPMISF
LLFLGIAFGFMWGIERTKNSGMGVVLLLGFTFFMGLMLSRILQVALGFSNGGSLIAMAAG
GTGAIFFTLATVATVTKKDFSFMGKFLFIGMVVILLAAVANIFFQIPALALTISAAAVMI
FSAYILYDISRIVTGGETNYIVATLSVYLDIYNVFVSLLNLLMAFTGERD