Protein Info for Dsui_2116 in Dechlorosoma suillum PS

Annotation: Fe-dependent oxidoreductase, alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00465: Fe-ADH
  • amino acids 9 to 178 (170 residues), 138.8 bits, E=2.1e-44
• PF13685: Fe-ADH_2
  • amino acids 16 to 110 (95 residues), 31.6 bits, E=2.3e-11
• PF25137: ADH_Fe_C
  • amino acids 190 to 382 (193 residues), 112.8 bits, E=2.6e-36

Best Hits

Swiss-Prot: 40% identical to YUGJ_BACSU: Probable NADH-dependent butanol dehydrogenase 1 (yugJ) from Bacillus subtilis (strain 168)

KEGG orthology group: K00100, [EC: 1.1.1.-] (inferred from 74% identity to ddc:Dd586_2851)

MetaCyc: 37% identical to BdhB (Clostridium acetobutylicum)
1.1.1.-

Predicted SEED Role

"NADH-dependent butanol dehydrogenase A (EC 1.1.1.-)" in subsystem Butanol Biosynthesis (EC 1.1.1.-)

MetaCyc Pathways

• pyruvate fermentation to butanol II (engineered) (5/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• glycerol degradation to butanol (10/16 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• butanol and isobutanol biosynthesis (engineered) (3/8 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

See G8QJ68 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Dsui_2116 Fe-dependent oxidoreductase, alcohol dehydrogenase (Dechlorosoma suillum PS)
MDNFTFFNPTQVEFGKDKEQAIGRHLAEHGIKKVLLCYGSERIKRDGLFGVVSKSLAEQG
ITFVECGGIVSNPVISKVREAIALARDHQVEAILSVGGGSVLDSSKAIAAGVPYAGDVWD
LFIGKGRIESALPVFDILTLAATGSEMNNGAVVTNEATQEKFAITSVHTYPKVSIVNPAL
MKTVSRDYLVYSAADVIAHAIEGYFTAKDEPRFQSRLVEAIINTVIETTETLLADPENYE
ARAEFAWAATQALNGLLYAGISGYSYPNHMIEHSLSALFNVPHGAGLSVVMPAWMKWYHS
RNPVQFQRFAKYVFGVETAEQGIAALEKWFDKIGTPTRLSQLGISEADLPKTIDNVLGNA
VHFGVAETYPRDVVATILKSAL