Protein Info for Dsui_2089 in Dechlorosoma suillum PS

Annotation: dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF00106: adh_short" amino acids 3 to 195 (193 residues), 149.5 bits, see alignment E=1.7e-47 PF23441: SDR" amino acids 5 to 251 (247 residues), 48.4 bits, see alignment E=1.7e-16 PF08659: KR" amino acids 6 to 171 (166 residues), 32.6 bits, see alignment E=1.6e-11 PF13561: adh_short_C2" amino acids 12 to 249 (238 residues), 177.9 bits, see alignment E=5.2e-56

Best Hits

KEGG orthology group: None (inferred from 80% identity to dia:Dtpsy_0177)

MetaCyc: 36% identical to (S)-sulfopropanediol 2-dehydrogenase (Cupriavidus pinatubonensis JMP134)
1.1.1.-

Predicted SEED Role

"Reductase"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJ42 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Dsui_2089 dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase like protein (Dechlorosoma suillum PS)
MTKIALITGGSRGLGRNAALKLAARGVDIILTYRSRADEAAAVVAQIEALGRRAVALPLA
VDEAAGFPAFAEAVRQALAGTWQRERFDFLVNNAGMGINAAFAETTEAQFDLLMNTHLKG
PFFLTQALLPLLNDGGRILNVSTGLARFALPGYAAYASMKGGIEVLTRYLAKELGPRGIA
VNVLAPGAIETDFGGGAVRDNAQLNAFIAAQTALGRVGQPDDIGHAVAALLSEETGWITA
QRIEASGGMFL