Protein Info for Dsui_2087 in Dechlorosoma suillum PS

Annotation: cytochrome c553

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00034: Cytochrom_C" amino acids 41 to 104 (64 residues), 28 bits, see alignment E=4.3e-10 amino acids 143 to 226 (84 residues), 28.3 bits, see alignment E=3.5e-10 PF13442: Cytochrome_CBB3" amino acids 42 to 104 (63 residues), 22.9 bits, see alignment E=8.7e-09

Best Hits

KEGG orthology group: None (inferred from 61% identity to pnu:Pnuc_0787)

Predicted SEED Role

"FIG135464: Cytochrome c4" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJ40 at UniProt or InterPro

Protein Sequence (244 amino acids)

>Dsui_2087 cytochrome c553 (Dechlorosoma suillum PS)
MRKLITPLLSGLLLLPALLPLSAQAVDGSDIMQKGGANPAAMPCITCHGTDGKGMAAAGF
PRLAGLPEAYIAKQLADFKAGRRENAVMQPIAQSLTPEEVAAVAKAYAELPKVNIKPGPV
ERPQPGSGAWIALRGAWERNIPECTLCHGPAGVGVGDTFPPLAGQSALYIENQLKAWRGT
KAVAATRKTKAVAAVPPSRRNDPNGLMAHIAVDLSEAEIKAVADYFAGLGESKEVFDESQ
HRLR