Protein Info for Dsui_2072 in Dechlorosoma suillum PS

Annotation: Pirin-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF02678: Pirin" amino acids 41 to 141 (101 residues), 115.7 bits, see alignment E=1e-37 PF05726: Pirin_C" amino acids 196 to 297 (102 residues), 100.9 bits, see alignment E=4.8e-33

Best Hits

Swiss-Prot: 55% identical to Y3240_PSEAE: Putative quercetin 2,3-dioxygenase PA3240 (PA3240) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06911, (no description) (inferred from 79% identity to dar:Daro_1390)

Predicted SEED Role

"Pirin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJ25 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Dsui_2072 Pirin-related protein (Dechlorosoma suillum PS)
MTTLHRTAPPAAPAAANAANAASRAVERLVRGMATSDGAGVRLTRVLTQNLQRRLDPFLM
LDAFRNENAEDYIGGFPDHPHRGFETVTYMIAGRMRHHDSVGNEGLLGPGGAQWMTAGSG
LIHSELPEQEEGLMEGFQLWLNLPARNKMVAPYYRDIPPAAIPEYTTAAGVRVRIIAGAS
QGVAGAVQRPDTEPLYLDIHLPAGSALFHEIPAGHNAFTYTYRGSVEVGGNVVPDRHMAI
LANDGAPGVHLAAAEDSRLLLVAGRPLGEPIAQYGPFVMNTAEEIQQAMRDYSAGHFAAA
PVRAL