Protein Info for Dsui_2059 in Dechlorosoma suillum PS

Annotation: ABC-type branched-chain amino acid transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 177 to 201 (25 residues), see Phobius details amino acids 214 to 239 (26 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 13 to 262 (250 residues), 143.3 bits, see alignment E=4.2e-46

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 72% identity to hse:Hsero_2933)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIL8 at UniProt or InterPro

Protein Sequence (287 amino acids)

>Dsui_2059 ABC-type branched-chain amino acid transport system, permease component (Dechlorosoma suillum PS)
MEWFNDFWSTYSTLVFSVGVHALLALSIWLTLSCGLLSLANAAFMGVGAYVSALLTLHLE
WSFGSVLLAGGIAPTLVALIIGAPVLRLSGVYLAMATLAFGEVVRITVLNLEITGGPEGL
NGIPLATEGWHIALILAVAVYGLARLRRSKVGRAFEAIKEDEVAARLMGINVDRYKLLAF
SLGAFIAGVAGALNAHFTFFISPREYGFENAVDILTMAVLGGTSSLIGPMLGSSILTLLP
ELLRSLQDFRSLVNGAVLVLVVLFLPKGLWESRRIRAFFKRLKGGQA